PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g008480.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 298aa    MW: 34040.1 Da    PI: 8.0571
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g008480.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.2e-321972255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH++Fv+a+e+LGG++kAtPk +l++m+v gLt+++vkSHLQ+YR+
  Sopim04g008480.0.1 19 PRLRWTPDLHHCFVHAIEKLGGQDKATPKLVLQMMDVRGLTISNVKSHLQMYRS 72
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6821575IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-311575IPR009057Homeodomain-like
SuperFamilySSF466891.97E-151774IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-241973IPR006447Myb domain, plants
PfamPF002491.1E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGNCGRNGGV RQYIRSKVPR LRWTPDLHHC FVHAIEKLGG QDKATPKLVL QMMDVRGLTI  60
SNVKSHLQMY RSMKSDVNKQ GERMTIQPSK EVCLGDLDCH YQQQEQEDEG CVEQQKLLVY  120
QYPLSFSSNP NMKRTDSTPY FNSVQPTKRA RIERCSIREA VSNEYNSRND YNTEKNETTQ  180
PLCNSTTHIF NPLTTSNELQ ESLFFKVLKT QDSNRDSLKR FKFEDSMKID NVREDDDERG  240
LSLSLSLHRP TTQRSNASSI ISEISETISS YSGGLNLNIW QSSSEKQNVN LNLSIAL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-153HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236899.20.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLK4BP040.0K4BP04_SOLLC; Uncharacterized protein
STRINGSolyc04g008480.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-34G2-like family protein